Protein Info for AO353_12055 in Pseudomonas fluorescens FW300-N2E3

Annotation: cell envelope biogenesis protein AsmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05170: AsmA" amino acids 1 to 629 (629 residues), 394.6 bits, see alignment E=1.1e-121 PF13502: AsmA_2" amino acids 476 to 656 (181 residues), 86.3 bits, see alignment E=2.5e-28

Best Hits

KEGG orthology group: K07289, AsmA protein (inferred from 84% identity to pba:PSEBR_a341)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WUR4 at UniProt or InterPro

Protein Sequence (743 amino acids)

>AO353_12055 cell envelope biogenesis protein AsmA (Pseudomonas fluorescens FW300-N2E3)
MKAFGKILGLVLLGLLLIIVALGFALTHFFDPNDYKDEIRQIARDKAHIELTLNGDIGWS
LFPWLGLELHDAGVATLANPTQPFADLQMLGLSVRVLPLLRREVQMSDVRVEGLNLRLNR
DKNGHGNWEDIGKVPPVAAKADAPATGSTSEPVAEVPATAEKPAQPIRLDIDSLTVNNAR
VEYNDEQTGKQFSAESIQLSTGPVHDATNIQVKLTAFLASNQPDVRVRTELNGELRFERA
LQRYQFEDMKLAGEISGEPLQGKIVTYAAQGQLLLDRAANVAEWTGIKISANQLRALGEL
KVNNLDKTPQISGGVSIAQFDLAKFVDSIGQKLPAMAEGSLSKVELVSRLAGTPSSVVLD
DLNLKVDDSSFSGRIAVEDFAKQSLRVQLKGDTFNADRYLPPKSAEANSAAVARQSEVSS
TETNALAGAGSTPLPNAPTKGAWSSDKLIPSERLSKLDLDADLTFGQLTLDKLSIQNAAL
KATGQGGLLTLENLRGDLYNGNFAAKGTLDVRQPVPLLSLQTQISKVPVENILESQGKKP
PVKGLVTLNSNLTASGNSQKALIDSLNGTASFVLNNGVLLNANLEQQLCKGIATLNHKTL
SGEPHGKDTPFQELKGNLTLRNGVASNPDLKVRIPGMTVNGNGDVDLRVLGMDYRIGIIV
EGDKSDMPDPACQVNERYAGIEWPLRCRGPLELGAKACRLDNERLGQVAGKLAGDKLGEK
IDEKLGDKVSPELKNALKGLFKR