Protein Info for AO353_11860 in Pseudomonas fluorescens FW300-N2E3

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF06490: FleQ" amino acids 10 to 123 (114 residues), 24.8 bits, see alignment E=9e-09 PF00072: Response_reg" amino acids 11 to 120 (110 residues), 101.3 bits, see alignment E=1.5e-32 PF00158: Sigma54_activat" amino acids 150 to 316 (167 residues), 229.4 bits, see alignment E=8.6e-72 PF14532: Sigma54_activ_2" amino acids 151 to 321 (171 residues), 77.7 bits, see alignment E=4.2e-25 PF07724: AAA_2" amino acids 172 to 300 (129 residues), 32.8 bits, see alignment E=2.8e-11 PF07728: AAA_5" amino acids 173 to 292 (120 residues), 36 bits, see alignment E=2.7e-12 PF18024: HTH_50" amino acids 403 to 452 (50 residues), 33.1 bits, see alignment 1.5e-11 PF02954: HTH_8" amino acids 409 to 448 (40 residues), 27.5 bits, see alignment 8.4e-10

Best Hits

Swiss-Prot: 78% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 90% identity to pba:PSEBR_a302)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHG9 at UniProt or InterPro

Protein Sequence (467 amino acids)

>AO353_11860 Fis family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MSNLIDNRIQVVLIDDDPHLRQALSQTLDLAGLKILPLAEAKGLASRLERDWPGVVVSDI
RMPGMDGLELLNELHAQDPELPVLLITGHGDVPLAVQAMRAGAYDFLEKPFASDALLDSV
RRALALRQLVLDNRSLRLALSDRNELSTRLVGQSAPMLRLREQIGALAPTKADVLILGET
GAGKEVVARALHDLSNRRNGPFVAINAGALAESVVESELFGHEPGAFTGAQKRRIGKFEF
ANGGTLFLDEIESMSLDVQVKLLRLLQERVVERLGGNQLIPLDIRIIAATKEDLRQSADQ
GRFRADLYYRLNVAPLRIPPLRERGEDALMLFQHFANEASERHGLPPHELQPGQRALLLR
HSWPGNVRELQNAAERFALGLELALDNSVPDGSAAPHSTVLGGNLSEQVESFEKNLIAAE
LARTHSSLRSVAEALGIPRKTLHDKLRKHGLNFADGAGTNSNADELD