Protein Info for AO353_11830 in Pseudomonas fluorescens FW300-N2E3

Annotation: formate dehydrogenase family accessory protein FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 38 to 272 (235 residues), 163.9 bits, E=2e-52
• PF02634: FdhD-NarQ
  • amino acids 40 to 273 (234 residues), 221.8 bits, E=5.9e-70

Best Hits

Swiss-Prot: 44% identical to FDHD_BORPD: Sulfur carrier protein FdhD (fdhD) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K02379, FdhD protein (inferred from 89% identity to pfs:PFLU0279)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See A0A0N9VNX6 at UniProt or InterPro

Protein Sequence (279 amino acids)

>AO353_11830 formate dehydrogenase family accessory protein FdhD (Pseudomonas fluorescens FW300-N2E3)
MKAKRPVCGAPAVEMPTPAASQNYQYCNLDHSESASTALAEEVALAIAYNGISQAVMLVT
PSDLEDFIVGFSLGSGIISDVSDLYDLQLSGSGSAQYAQVSISSRAFWNLKQQRRQLAGT
SGCGLCGVEAVEQALPQLNVLPGAPLPPAQWLEGLRQRIGEFQPLGQYSGAVHAAVFMNN
QGELLLGREDIGRHNALDKLIGALIRQNIPMAGGLVIVTSRCSLELIQKVLRAGIQTLVS
LSSPTGLAVQWARRHNLNLIHLPQKSAPRVYSPATENQA