Protein Info for AO353_11810 in Pseudomonas fluorescens FW300-N2E3

Annotation: recombinase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 4 to 342 (339 residues), 374.2 bits, see alignment E=5e-116 PF04851: ResIII" amino acids 14 to 175 (162 residues), 27.4 bits, see alignment E=5.7e-10 PF00270: DEAD" amino acids 15 to 177 (163 residues), 81.9 bits, see alignment E=9.6e-27 PF00271: Helicase_C" amino acids 213 to 321 (109 residues), 77.4 bits, see alignment E=2.1e-25 PF16124: RecQ_Zn_bind" amino acids 510 to 555 (46 residues), 33.1 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 91% identity to pfl:PFL_0289)

Predicted SEED Role

"ATP-dependent DNA helicase, RecQ family" in subsystem DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WUN3 at UniProt or InterPro

Protein Sequence (644 amino acids)

>AO353_11810 recombinase RecQ (Pseudomonas fluorescens FW300-N2E3)
MHNTLEQVFGYPQFRPGQEAAVSAVLAGRSAAAIFPTGSGKSLCYQLPALLLPHLTLVVS
PLLALMQDQLAFLQRHGIAAASIDSAQSRDDANEVMARARSGELKILMISVERLKNERFR
NFLQQVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQRQFNIPQALLLTATATPKVIADM
QAKFAIAANDVVTTGFYRPNLNLLVEPVRGQDKRRRLVEWMSQRAGQPSIVYVTLQKTAE
QIAQHLSQNGLQAEAYHAGLPHEQREAIQRRFMGGQSNCIVATIAFGMGIDKSDIRNVVH
FDLPKSIENYSQEIGRAGRDGQPSDCLVLANRDSLNVLENFVYGDTPELDGIRCVLDELQ
AAAPDGQWEFLLGPLADQSNIRQLPLKTLLVQLELKGLIAPRYAYFAEYRFKFLLEPEAL
LARFEGERRDFVEAIIQTSSRARTWATVNFEALYQQHQAERNRVVKALDYFQEKGWVELE
SKQMTEVYSLLLTDFDAQVLSAELHGYFTQHERTEIARIHAMLDLFATEHCLGYRLAQYF
GDENAPQQCGHCSVCHGQVARLPEPPELPALVDKNFESLCGDFIHRHEAYNGDLPGAERL
TRFLCGISVPLFTKLKARAIPGFAALEDYPYAEVREWAEANLTD