Protein Info for AO353_11750 in Pseudomonas fluorescens FW300-N2E3

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details PF00672: HAMP" amino acids 167 to 216 (50 residues), 40.4 bits, see alignment 4.4e-14 PF00512: HisKA" amino acids 222 to 274 (53 residues), 39.5 bits, see alignment 7.3e-14 PF02518: HATPase_c" amino acids 322 to 428 (107 residues), 85.9 bits, see alignment E=4e-28

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 96% identity to pba:PSEBR_a282)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHF3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>AO353_11750 ATPase (Pseudomonas fluorescens FW300-N2E3)
MKTPVWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQYSHGVALTLRAYWAA
DEENRAKIADAATLIRVVGAGVPEGEQHWPYSEIYQRQMQAELGADTEVRLRMHAPPALW
VRAPSLGDGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLSTASAWIFVSQLNQPLKRLVDA
ARQLGQGRSVRLPISDTPSEMTEVYRAFNQMAEDVEQAGRERELMLAGVSHDLRTPLTRL
RLSLELMGNHSDLSDDMVRDIEDMDAILDQFLAFIRDGRDESVEEVDLSDLVREVAAPYN
QNEERVRLRLEPIQPFPLRRVSMKRLLNNLIGNALHHAGSGVEVAAYVSGDVSAPYVVLS
VMDRGAGIDPSELEAIFNPFTRGDRARGGKGTGLGLAIVKRIASMHGGNVELRNRSGGGL
EARVRLPLGLMLPRDAV