Protein Info for AO353_11735 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF14539: DUF4442" amino acids 11 to 124 (114 residues), 38.5 bits, see alignment E=1.9e-13 TIGR00369: uncharacterized domain 1" amino acids 12 to 125 (114 residues), 82.5 bits, see alignment E=1.2e-27 PF13622: 4HBT_3" amino acids 41 to 125 (85 residues), 43.8 bits, see alignment E=3.7e-15 PF03061: 4HBT" amino acids 42 to 116 (75 residues), 68.1 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 94% identity to pfo:Pfl01_0258)

Predicted SEED Role

"Uncharacterized protein, possibly involved in aromatic compounds catabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VTG3 at UniProt or InterPro

Protein Sequence (127 amino acids)

>AO353_11735 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MEIPAGLTESAFFKLLGCRLHSLEVGVAQVALALEPQLRNRGGKLHGGALFSLVDIAMGL
ACSSSHGFDQQSATIECKINYIRAVAEGEVMCTARVIHPGRRTLVVEADVMQGDKLVAKA
QGTFAVL