Protein Info for AO353_11690 in Pseudomonas fluorescens FW300-N2E3

Annotation: choline transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 410 to 434 (25 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details amino acids 479 to 499 (21 residues), see Phobius details PF02028: BCCT" amino acids 18 to 502 (485 residues), 600.1 bits, see alignment E=1.4e-184 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 56 to 502 (447 residues), 508.4 bits, see alignment E=8.4e-157

Best Hits

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 95% identity to pba:PSEBR_a270)

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VU43 at UniProt or InterPro

Protein Sequence (667 amino acids)

>AO353_11690 choline transporter (Pseudomonas fluorescens FW300-N2E3)
MSASFTPPSGQIRMNPPVFYFAATFILLFGLVVIAFPQESGAWLLAAQNWAANTVGWYYM
LAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAAGISITLFFFCVSEPLT
HMLQPPQGEAGTADAARQAMQVLFLHWGLHGWGVFAFVGMALAYFAYRHNLPLALRSALY
PLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNSGLDYLFGIAHTQWIQVGLIT
LMMGAAIIVAVAGVDKGVRVMSDINMLLACALLLFVLFAGPTQHLLNTLIQNLGDYLGAL
PMKSFDLYAYDKPSDWLGGWTVFYWAWWIAWSPFVGLFIARISRGRTIREFVFGVLLIPL
GFTLAWMSIFGNSAIDQVLNHGMSALGLSAIENPSMTLYLLLETYPWSKTVIAVTVFISF
VFFVTSADSGTVVLSTLSAKGGNADEDGPKWLRVFWGAMTALVTSALLFAGSIDSLKSAV
VLTSLPFSLILLLMMWGLHKAFYLESQKQIAQLHSLAPVSASSRRGKGGWRQRLSQAVHF
PSRDEVYRFLDTTVRPAIEEVTAVFAEKGLNVVTQPDPANDSVSLEIGHGEQHPFIYQAQ
MRGYFTPSFARGGMGSKELNNRRYYRAEVHLSEGSQDYDLVGYTKEQIINDILDQYERHM
QFLHLVR