Protein Info for AO353_11600 in Pseudomonas fluorescens FW300-N2E3

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 65 to 109 (45 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 88.4 bits, see alignment E=1.8e-29 PF00528: BPD_transp_1" amino acids 35 to 214 (180 residues), 65.5 bits, see alignment E=2.7e-22

Best Hits

Swiss-Prot: 34% identical to PATM_VIBHA: Probable amino-acid ABC transporter permease protein PatM (patM) from Vibrio harveyi

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to pfo:Pfl01_0225)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W5G3 at UniProt or InterPro

Protein Sequence (221 amino acids)

>AO353_11600 polar amino acid ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MTFDYAFILSTLPAFLRAVGVTLQVGLIAIGTSLLVALINATLLVFRTPYLQRLVALYVE
LARNTPLLIQLFFVYFALPALGVKVSGFAAAIITMTFLGGAYLTEVLRAGVEAVPAAQLE
SGRSIGLSHWQLLRYVILPQAGILSLPSLFANFIFLLKETTVVSAVAVPEILYTTKSYIA
LYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRLQHGQFGS