Protein Info for AO353_11325 in Pseudomonas fluorescens FW300-N2E3

Annotation: serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details PF24961: NfeD_membrane" amino acids 26 to 98 (73 residues), 34.3 bits, see alignment E=2.2e-12 PF01957: NfeD" amino acids 114 to 168 (55 residues), 40.5 bits, see alignment E=2.6e-14

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 66% identity to pfo:Pfl01_0167)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZY5 at UniProt or InterPro

Protein Sequence (178 amino acids)

>AO353_11325 serine protease (Pseudomonas fluorescens FW300-N2E3)
VNTRWWYVVALLLGLSGSAFATDTVVVVVPNPLGVWLMMVGIALLVAEVVLPNYGVVGLG
GITMFVIGAVMVSNADVPAPLIIGLGLISALLLIALLFHALKTRPRHIVSGDAGLLGSVT
QVTALQGHNTHKGWVHLQGERWQVHCKTPLHSGQRVRVVARKGTLLEVAAADAAPQGE