Protein Info for AO353_11305 in Pseudomonas fluorescens FW300-N2E3

Annotation: adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 14 to 190 (177 residues), 202.6 bits, E=2.1e-64
• PF01583: APS_kinase
  • amino acids 26 to 180 (155 residues), 180.9 bits, E=1.7e-57
• PF08433: KTI12
  • amino acids 30 to 109 (80 residues), 30.1 bits, E=3.7e-11

Best Hits

Swiss-Prot: 48% identical to CYSC_PROMA: Adenylyl-sulfate kinase (cysC) from Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 85% identity to pfo:Pfl01_0162)

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A0N9WFA9 at UniProt or InterPro

Protein Sequence (201 amino acids)

>AO353_11305 adenylylsulfate kinase (Pseudomonas fluorescens FW300-N2E3)
MSKASNLLAPTASVSRAQREDRHGHRGAAILLTGLPAAGKSTLAQALHAALFERGLHSLV
LDGDGLRVGLNRDLGFADKDRQENIRRASEVAALLVENGQIVILAMIAPLVELREIFARR
LGEDYREVWCSASLNVCEQRDPKGHYARARSGELPGFTGISAPYEPPASAALVLDTGVQS
VDACLDRLLTWLGECAVLPHR