Protein Info for AO353_11175 in Pseudomonas fluorescens FW300-N2E3

Annotation: tryptophan synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfo:Pfl01_0132)

Predicted SEED Role

"Tryptophan synthase beta chain like (EC 4.2.1.20)" (EC 4.2.1.20)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• DIBOA-glucoside biosynthesis (1/6 steps found)
• superpathway of benzoxazinoid glucosides biosynthesis (1/13 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

See A0A0N9WBT0 at UniProt or InterPro

Protein Sequence (112 amino acids)

>AO353_11175 tryptophan synthase subunit beta (Pseudomonas fluorescens FW300-N2E3)
MFYVQRDAQGQLVRVEATAYAEATETLPSDHHEIQAWYANEVMETSLKQLKQSDLEMIRV
LDDLIQVLTSKGVIRVTDLPAAAQAKLMDRTQAREALGGLSHLIDEDEGGLI