Protein Info for AO353_11035 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details PF03741: TerC" amino acids 14 to 204 (191 residues), 164.2 bits, see alignment E=1.4e-52

Best Hits

Swiss-Prot: 60% identical to Y056_HAEIN: UPF0053 protein HI_0056 (HI_0056) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 96% identity to pfl:PFL_0104)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VNK8 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AO353_11035 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MEWLTNPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQARTRIFGLALAMVTRIL
LLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSSQEMFHALEGEDETADEPG
GKGGNFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVAAIIVAVLVMMMASGMISAFI
DKHPSLKMLALSFLLVVGTVLIAEAFGVHVPKGYVYFAMAFSLAVEAINIKMRTAIAKKK
KQQEPVKLRKDIPGQ