Protein Info for AO353_10920 in Pseudomonas fluorescens FW300-N2E3

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00938: homoserine kinase" amino acids 1 to 303 (303 residues), 288.4 bits, see alignment E=3.4e-90 PF01636: APH" amino acids 27 to 255 (229 residues), 150.8 bits, see alignment E=2.9e-48

Best Hits

Swiss-Prot: 72% identical to KHSE_PSEA8: Homoserine kinase (thrB) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 93% identity to pfl:PFL_0080)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WBQ1 at UniProt or InterPro

Protein Sequence (316 amino acids)

>AO353_10920 homoserine kinase (Pseudomonas fluorescens FW300-N2E3)
MSVFTPLARPELETFLAPYGLGRLLDFQGIAAGSENTNFFISLEQGEFVLTLVERGPVQE
MPFFIELLDVLHDANLPVPYALRTTDGIALRELAGKPALLQPRLAGKHIKEANAQHCAQV
GELLGHLHLATKDHMIKRKTDRGLDWMLEEGTQLLSHLNAAQSNLLQRALNEITEQKIKI
LALPRANIHADLFRDNAMFEGTHLTGLIDFYNACSGPMLYDVAIALNDWCSDEDGVLDGP
RARALLGAYAALRPFTAAEAELWPTMLRVACVRFWLSRLIAAESFAGQDVLIHDPMEFQQ
RLAQRQHVSTPLPFAL