Protein Info for AO353_10905 in Pseudomonas fluorescens FW300-N2E3

Annotation: zinc ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 149 (129 residues), 100.2 bits, E=1.6e-32

Best Hits

Swiss-Prot: 92% identical to ZNUC_PSEF5: Zinc import ATP-binding protein ZnuC (znuC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 96% identity to pba:PSEBR_a35)

MetaCyc: 59% identical to Zn2+ ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.2.2.20

Sequence Analysis Tools

See A0A0N9VTY0 at UniProt or InterPro

Protein Sequence (261 amino acids)

>AO353_10905 zinc ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E3)
MSTALIRLNQVAVTFAGQSVLDNIELSVEPRQIVTLIGPNGAGKTTLVRAVLGLLKPDSG
SVWRKPKLRVGYMPQKLHVDPTLPLSVLRFLRLVPGVDRARALAALKEVGAEQVIDSPVQ
SVSGGEMQRVLLARALLREPELLVLDEPVQGVDVAGQAELYSLITRLRDRHGCGVLMVSH
DLHLVMSTTDQVVCLNRHVCCSGHPEQVSGDPAFVELFGKNAQSLAVYHHHHDHAHDLHG
SVVSAAPTVHTHVHGDGCKHG