Protein Info for AO353_10835 in Pseudomonas fluorescens FW300-N2E3

Annotation: cytochrome oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 162 to 190 (29 residues), see Phobius details amino acids 202 to 229 (28 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 313 to 315 (3 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 356 to 379 (24 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details amino acids 430 to 451 (22 residues), see Phobius details amino acids 470 to 491 (22 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 27 to 530 (504 residues), 700.6 bits, see alignment E=5.6e-215 PF00115: COX1" amino acids 35 to 477 (443 residues), 536.7 bits, see alignment E=2.3e-165

Best Hits

Swiss-Prot: 55% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 97% identity to pfl:PFL_0062)

MetaCyc: 94% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WU72 at UniProt or InterPro

Protein Sequence (531 amino acids)

>AO353_10835 cytochrome oxidase subunit I (Pseudomonas fluorescens FW300-N2E3)
MNAVNDDHGHAIVDDHVHGPAKGLMRWVLTTNHKDIGTLYLWFSFMMFLLGGSFAMVIRA
ELFQPGLQIVEPAFFNQMTTMHGLVMVFGAVMPAFVGLANWMIPLMIGAPDMALPRMNNF
SFWLLPAAFLLLVSTLFMPGGGPNFGWTFYAPLSTTYAPESVTFFIFAIHLMGISSIMGA
INVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGCVTMMLMDIHFGTSFFS
AAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPTFSRKPLFGYTSMVYATASIAF
LSFIVWAHHMFVVGIPLVGELFFMYATLLIAVPTGVKVFNWVSTMWQGSLTFETPMLFAV
AFVILFSIGGFSGLMLAIAPADFQYQDTYFVVAHFHYVLVPGAIFGIFASAYYWMPKWTG
HMYDETLGKLHFWLSFIGMNMAFFPMHFVGLAGMPRRIPDYNLQFADFNMVSSIGAFTFG
ATQIFFLFIVIKTIRGGPAAPAKPWEGAEGLEWSVPSPAPYHTFVTPPEVK