Protein Info for AO353_10600 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 10 to 301 (292 residues), 533.8 bits, see alignment E=5.3e-165 PF02091: tRNA-synt_2e" amino acids 11 to 292 (282 residues), 496.4 bits, see alignment E=1.1e-153

Best Hits

Swiss-Prot: 99% identical to SYGA_PSEFS: Glycine--tRNA ligase alpha subunit (glyQ) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 99% identity to pba:PSEBR_a12)

MetaCyc: 76% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H160 at UniProt or InterPro

Protein Sequence (317 amino acids)

>AO353_10600 glycine--tRNA ligase subunit alpha (Pseudomonas fluorescens FW300-N2E3)
VSQPTPAVRTFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAY
VQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPDNFQELYLGSLKHVGLDPLVHDIRFVE
DNWESPTLGAWGLGWEVWLNGMEVTQFTYFQAAGGIECYPVTGEITYGLERLAMYLQGVD
SVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEAKRLIELDQ
PLPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLLARAKLGFPM
ATPDLRDEVLAKLEAAQ