Protein Info for AO353_10545 in Pseudomonas fluorescens FW300-N2E3

Annotation: ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 117 to 134 (18 residues), see Phobius details amino acids 149 to 163 (15 residues), see Phobius details PF00970: FAD_binding_6" amino acids 14 to 100 (87 residues), 26.5 bits, see alignment E=1e-09 PF00111: Fer2" amino acids 266 to 340 (75 residues), 62.3 bits, see alignment E=4.9e-21

Best Hits

KEGG orthology group: None (inferred from 54% identity to del:DelCs14_3096)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VTV4 at UniProt or InterPro

Protein Sequence (352 amino acids)

>AO353_10545 ferredoxin (Pseudomonas fluorescens FW300-N2E3)
MNGITLQARCERVTTETAGVKVFTLRAQGAHAEFLNSLEPGKHVALHYPDTAGTEHQRLY
SITRKQGADLFEIAVKREGRGGVSDHLHATLQEGSTVPMQFVAGEISLASIVGCQQVGML
AGGIGITLPIALLRELLERSRRGLSVPRVALLLCVPTITEIPFLHELLELELTTPWFTLR
VFVTRETVKSNVHFTAGRPGAKDLSFLGMPEAVVICGSHRFAQGLREHTLAMFPASKLLI
ESFTPPAAPVATEQTDAQASASVRLHLADSDQAIEVPAGKSLLDMLESSGIAVRSLCRAG
ICGNCRIKVSDGEYILEPDFCLSDQDKDEGYALACCTFPQSGTIKVDLNPSI