Protein Info for AO353_10535 in Pseudomonas fluorescens FW300-N2E3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 303 to 319 (17 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 214 (204 residues), 74.3 bits, see alignment E=4.4e-25 amino acids 235 to 384 (150 residues), 54.7 bits, see alignment E=4.2e-19

Best Hits

KEGG orthology group: None (inferred from 64% identity to ppg:PputGB1_1566)

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VW66 at UniProt or InterPro

Protein Sequence (405 amino acids)

>AO353_10535 MFS transporter (Pseudomonas fluorescens FW300-N2E3)
IVHIGLLPQVATAHFVSHLHIMVLAALFPVLPDFFGVGYVELGLALSIFNIVTALVQAPM
GFVVDHYGARRLLIAGVALGSISFLLIALFPSYGCLLVVMVLAGVANAVYHPANYALLSQ
EINPAHIGKAFSVHTFAGFLGAAIAPVFLLGIATASDPGLAFVGAALAGFFALGLLLIPG
SGLARVAQVRCALEPALNIASTRRLSLLSPMILSLTLLFVLLNLSTSAIEKFSVAALMQG
QGATLSWANSALTAFLFASAFGVLAGGALADRTQRHGMVAATAFALAAAITAIVATASLS
EPALIIALGAAGFLTGLIAPSRDMLVRAASPKGAEGKTFGIVSTGFNVGGAIGPIGFGWM
LDQEHPTAIFWASVTFMSLTVVLTLMQEWYLARSRKSTPLLVAFK