Protein Info for AO353_10405 in Pseudomonas fluorescens FW300-N2E3

Annotation: ATP synthase F0F1 subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00213: OSCP
  • amino acids 7 to 176 (170 residues), 181.9 bits, E=5.7e-58
• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 8 to 176 (169 residues), 164.9 bits, E=1.1e-52

Best Hits

Swiss-Prot: 96% identical to ATPD_PSEPF: ATP synthase subunit delta (atpH) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 96% identity to pfo:Pfl01_5733)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A0A0N9WHK8 at UniProt or InterPro

Protein Sequence (178 amino acids)

>AO353_10405 ATP synthase F0F1 subunit delta (Pseudomonas fluorescens FW300-N2E3)
MAELTTLARPYAKAAFEHAQAHQQLASWSAMLGLAAAVSQDDTMQRVLKAPRLTSADKAA
TFIDVCGDKFDAKAQNFINVVAENDRLPLLPEISALFDLYKAEQEKSVDVEVTSAFALNQ
EQQDKLAKVLSARLNREVRLQVEEDKSLIGGIVIRAGDLVIDGSVRGKLANLAEALKS