Protein Info for AO353_10380 in Pseudomonas fluorescens FW300-N2E3

Annotation: bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 1 to 436 (436 residues), 610.7 bits, see alignment E=8.4e-188 PF12804: NTP_transf_3" amino acids 3 to 103 (101 residues), 49.3 bits, see alignment E=1.3e-16 PF00483: NTP_transferase" amino acids 6 to 181 (176 residues), 34.6 bits, see alignment E=3.1e-12 PF00132: Hexapep" amino acids 248 to 281 (34 residues), 31.6 bits, see alignment 1.9e-11 PF14602: Hexapep_2" amino acids 266 to 298 (33 residues), 16.5 bits, see alignment (E = 1.1e-06) amino acids 377 to 410 (34 residues), 21 bits, see alignment 4.6e-08

Best Hits

Swiss-Prot: 91% identical to GLMU_PSEPF: Bifunctional protein GlmU (glmU) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 91% identity to pfo:Pfl01_5728)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WBH1 at UniProt or InterPro

Protein Sequence (440 amino acids)

>AO353_10380 bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase (Pseudomonas fluorescens FW300-N2E3)
MRSALPKVLHPVAGNSMLGHVIHSARQLDPQRIHVVIGHGADVVRERLAADDLNFVLQDQ
QLGTGHAVAQAVPFITADTVLILYGDVPLIEVPTLQRLLKLVAPLQMGLLTVELDDPTGY
GRIVRNADGRVTAIVEHKDASEAERMITEGNTGIMSVPASHLGDWMSRLSNNNVQGEYYL
TDVIAMAVSDGLVVDTEQPHDAMEVQGANDRKQLAELERHYQLREGRRLMAQGVTLRDPA
RFDVRGEVTVGRDVLIDINVILEGRVVIEDDVVIGPNCVIKDSTLRKGVVIKANSHIEGA
VLGEGSDAGPFARLRPGTVLEARAHVGNFVELKNAHLGEGAKAGHLTYLGDAEVGARTNI
GAGTITCNYDGVNKWKTVLGEDVFIGSNNSLVAPVDILDGATTAAGSTITSTVDKSQLAV
GRARQKNIDGWKRPVKVQKS