Protein Info for AO353_10315 in Pseudomonas fluorescens FW300-N2E3

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 50 to 82 (33 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 200 to 228 (29 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 325 to 359 (35 residues), see Phobius details amino acids 378 to 406 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 21 to 384 (364 residues), 302.3 bits, see alignment E=4.6e-94 PF01740: STAS" amino acids 439 to 525 (87 residues), 61.7 bits, see alignment E=5.1e-21

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 79% identity to avn:Avin_24970)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VNB6 at UniProt or InterPro

Protein Sequence (552 amino acids)

>AO353_10315 sulfate transporter (Pseudomonas fluorescens FW300-N2E3)
MIAIREAWKAGLLRPEHWLRNIVSGVIVGVVALPLAMAFAIASGVKPEQGIYTAIVSGLL
VSLFGGSRLQIAGPTGAFVVILSGVTAKYGVDGLQIATMMAGAILLLLGITKLGAIIKFI
PDPVIVGFTAGIGVIIWVGQWKDFFGLPKISGEHFHERLWHLVQALPSFHVPTTLLALSS
LVLVITAPKIPGIRRVPGPLIAMVVVTALQAFFQFAGVATIGSAFGGIPQGLPEVGLPAI
TLPQVIELIGPAFAIAMLGAIESLLSAVVADGMAGTKHDSNQELIGQGIANLVTPLFGGF
AATGAIARTATNIRNGGNSPIAGFVHALTLILLILFLAPLASDIPLCALAAILFVVAYNM
SELKHFQRMVKRAPKADVAILLITFSLTVFSDLAIAVNIGVILAMLQFMRRMASSVEVQQ
MVEKELEVELRINGHVRLPPGVLVYTIEGPLFFGAAETFERVLAQTHTDPGTLIIRLKRV
PFMDITGLQTLLEVIEHLRKRSIVVKLCEANEKVLGKLDKAGILQALGPEHYHADFSGAL
GSFEIDKTPHLG