Protein Info for AO353_10295 in Pseudomonas fluorescens FW300-N2E3

Annotation: nitrate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF00005: ABC_tran" amino acids 34 to 173 (140 residues), 115.8 bits, see alignment E=2.5e-37 PF09821: AAA_assoc_C" amino acids 309 to 425 (117 residues), 130.5 bits, see alignment E=4.8e-42

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 80% identity to cvi:CV_4284)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WTY9 at UniProt or InterPro

Protein Sequence (440 amino acids)

>AO353_10295 nitrate ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E3)
MNSQAEKTGAHSEIYALKNVCRGFGKGKDELQVLSDVDLTLREGEIVGMLGRSGSGKSTL
LRIIAGLILPSSGEVRYNGSLLTGPAEGVAMVFQTFALFPWLTVLENVEAGLQALQVEPK
AARKRALAAIDLIGLDGFENAYPRELSGGMRQRVGFARALVVNPTLLLMDEPFSALDVLT
AETLRTDLLDLWSGGQLPIKSILIVTHNIEEAVLMCDRVLVLSSNPGRVVAQIRVPFAHP
RNRLDPAFRKMVDDIYALMTNRRSADAKTGKAELQLGSPLPEVSTNLMAGLISALAAEPY
YGQDSLSNVAERLLLEVDDLFPVAEMLEHLGFAELKGADIKLTDAGKLFDEYGTQERKTI
FADHLLRYVPLAARIRQVLQERRGHWAPRVRFEQELGDSLSDTAVEETLENVISWGRYAE
IFSYDDNTETFSLEDVEGSL