Protein Info for AO353_10270 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 52 to 172 (121 residues), 38.4 bits, E=3.3e-13
• PF00534: Glycos_transf_1
  • amino acids 197 to 350 (154 residues), 107 bits, E=2.1e-34
• PF20706: GT4-conflict
  • amino acids 197 to 308 (112 residues), 55.7 bits, E=1e-18
• PF13692: Glyco_trans_1_4
  • amino acids 199 to 339 (141 residues), 88.7 bits, E=1.1e-28
• PF13524: Glyco_trans_1_2
  • amino acids 282 to 363 (82 residues), 25.8 bits, E=2.6e-09

Best Hits

KEGG orthology group: K12994, alpha-1,3-rhamnosyltransferase [EC: 2.4.1.-] (inferred from 77% identity to pfo:Pfl01_5687)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See A0A0N9W4X5 at UniProt or InterPro

Protein Sequence (376 amino acids)

>AO353_10270 glycosyl transferase (Pseudomonas fluorescens FW300-N2E3)
MQIALNARILQAPRTGIGHYLAELVNALTHEPDLELSFFHGWGWSSSLPAAAMPAYSRLT
PLLRQIPGAYQARRWLEQRRFDQGHSKAIDLYHEPSLWPLAFKGPTIITLHDLTHLHYPS
TQPAARLREIERRLGQGVRQARLILTDSQFVADEAQRYFGLGPERFVVAPLGAAARFHPR
SNQFLQQALHPHGVQPQGYFLCVGTLEPRKNLSLALRAHAQLPEALRQHFPLLVVGMAGW
KGEQLVNELHTALASGHVRLLGYLPDEQVAELLAGARALVFPSIYEGFGLPVLEAMASGT
PVILTRRSAMPEVAGAAGNYIEPDDLHGLSEAMRCLADDQAHWQACREAGLRQAKLFSWE
RCAAITASAYHQALGG