Protein Info for AO353_10050 in Pseudomonas fluorescens FW300-N2E3

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 955 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details PF08447: PAS_3" amino acids 304 to 387 (84 residues), 70.9 bits, see alignment E=3e-23 amino acids 425 to 509 (85 residues), 37.9 bits, see alignment E=6.1e-13 TIGR00229: PAS domain S-box protein" amino acids 304 to 400 (97 residues), 26.9 bits, see alignment E=4.5e-10 amino acids 399 to 522 (124 residues), 66.4 bits, see alignment E=2.7e-22 PF13188: PAS_8" amino acids 405 to 449 (45 residues), 27.7 bits, see alignment 6.9e-10 PF00989: PAS" amino acids 407 to 512 (106 residues), 42.2 bits, see alignment E=2.7e-14 PF08448: PAS_4" amino acids 408 to 518 (111 residues), 42.1 bits, see alignment E=3.1e-14 PF13426: PAS_9" amino acids 413 to 514 (102 residues), 52.4 bits, see alignment E=2e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 526 to 685 (160 residues), 108 bits, see alignment E=4.1e-35 PF00990: GGDEF" amino acids 528 to 683 (156 residues), 139.5 bits, see alignment E=3.2e-44 PF00563: EAL" amino acids 704 to 939 (236 residues), 251.6 bits, see alignment E=2.4e-78

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfo:Pfl01_5643)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VSX5 at UniProt or InterPro

Protein Sequence (955 amino acids)

>AO353_10050 diguanylate cyclase (Pseudomonas fluorescens FW300-N2E3)
MTLSPSLSGPSVEPRVIRKQYAMEMAVERTRLLYQGSLLPTLFMLINGLVCAGLLWSPQR
YFLVSIWLIWLLSLVALRVIQVAAFDSAMPSRQAQPVWRRMFLLGSAMTGLTLAGAGIAL
VPTDSFLQQAWVFGLIGAATLSASVAYAVSLPAFLSFTLPCLLPAIGYLFWGGDEQQQGW
GWLGLILLGSLSVVAWQVNRLIQHGLMRRFQNQALIEHLQQAQSRSEQLNQELAREIEQR
RHAEEELREAQVGLESRVAQRSRELDAANQALSKSEARLALALKASELGLWDWNLQTDEV
HHTQLKELFGIEPEFVTAMLSHLKPRLHPQDLPPLRRALVEHLKGRTEDYQIEYRVRHGD
GHWVWIEDRGRAVERGANGRVIRMVGTRRDISVSKGLEEQRQLAATVFEAASEGIVIFDP
DYALIAVNQAFSRVTGYQIEDLLGRNVVELPCSRDARRHYSVIHQALEQQGSWQGELVEA
RKNGELYPQWLQLNAVRDTRGNVSHIVGFFADLSARRESEERMRYLTHYDELTGLANRSL
FRERLHEAHQRVRQGGRSLALLHINLDRFKLLNDSLGHEVADQMLQKIARRLVNALPEAD
TIARLSGDEFAVLFDAYGNLSSLARVATRLSTKLRLPLTVEGHELVVSASMGISMLPDNA
REISALVSQSNMAMQHAKHLGGNNFQFYTDSLQASTLERLQLENQLRKAIEEKQLKVFYQ
PKLCLATGRLNAAEALVRWDHPTMGQVPPGDFIGLAEEVGLIGAIGEFVLRQACWQACEW
QRQGLEPIRVSVNLSVHQLRQGKLVSLVRQVLEETGLAPHYLELELTESQLLDSVEHIIA
TFQQLRDLGVKLAIDDFGTGYSSLSYLKRIPVDYVKIDQAFIRGLGEGGEDAAITRAIIA
MAHGLSLKVVAEGVETAEQLAFLEAESCDEVQGYLISRPVEAFKLASLLRGERPE