Protein Info for AO353_10025 in Pseudomonas fluorescens FW300-N2E3

Annotation: pyruvate carboxylase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 PF00682: HMGL-like" amino acids 5 to 267 (263 residues), 158.9 bits, see alignment E=3.7e-50 TIGR01108: oxaloacetate decarboxylase alpha subunit" amino acids 7 to 597 (591 residues), 838.1 bits, see alignment E=1.8e-256 PF02436: PYC_OADA" amino acids 292 to 482 (191 residues), 193.6 bits, see alignment E=6.7e-61 PF00364: Biotin_lipoyl" amino acids 535 to 600 (66 residues), 62.3 bits, see alignment E=6.1e-21 PF13533: Biotin_lipoyl_2" amino acids 571 to 601 (31 residues), 30 bits, see alignment (E = 7.1e-11)

Best Hits

KEGG orthology group: K01960, pyruvate carboxylase subunit B [EC: 6.4.1.1] (inferred from 96% identity to pba:PSEBR_a5592)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.1

Use Curated BLAST to search for 6.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WIH5 at UniProt or InterPro

Protein Sequence (602 amino acids)

>AO353_10025 pyruvate carboxylase subunit B (Pseudomonas fluorescens FW300-N2E3)
MTKKIHVTDTILRDAHQSLLATRMRTDDMLPICDKLDKVGYWSLEVWGGATFDACVRFLK
EDPWERLRKLRAALPNTRLQMLLRGQNLLGYRHYSDDVVKAFVAKAAVNGIDVFRIFDAM
NDVRNLRVAIEAVKAAGKHAQGTIAYTTSPVHTIEAFVEQARQMEAMGCDSVAIKDMAGL
LTPYATGELVKALKSEQSLPVFIHSHDTAGLAAMCQLKGIENGADNIDTAISSFAWGTSH
PGTESMVAALKGSEFDTGLSLELLQEIGLYFYAVRKKYHQFESEFTAVDTRVQVNQVPGG
MISNLANQLKEQGALNRMSEVLAEIPRVREDLGFPPLVTPTSQIVGTQAFFNVLAGERYK
TITNEVKLYLQGGYGKAPGVVNEQLRRQAIGSEEVIDVRPADLIKPEMTKLRGEVGALAK
SEEDVLTYAMFPDIGRKFLEEREAGTLTPEVLLPIPEAGGVTSAGGEGVPTEFVIDVHGE
TYRVDITGVGVKSEGKRHFYLSIDGMPEEVVFEPLNEFVSGGSSKRKQASAPGHVSTTMP
GNIVDVLVKEGDTVKAGQAVLITEAMKMETEVQSAIAGKVTAIHVAKGDRVNPGEILIEI
EG