Protein Info for AO353_09900 in Pseudomonas fluorescens FW300-N2E3

Annotation: phosphate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 760 transmembrane" amino acids 39 to 64 (26 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details amino acids 499 to 522 (24 residues), see Phobius details amino acids 528 to 547 (20 residues), see Phobius details amino acids 566 to 590 (25 residues), see Phobius details amino acids 611 to 630 (20 residues), see Phobius details amino acids 659 to 680 (22 residues), see Phobius details amino acids 725 to 746 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 94% identity to pfo:Pfl01_5614)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VTP6 at UniProt or InterPro

Protein Sequence (760 amino acids)

>AO353_09900 phosphate ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MNDLANSTMTTNPPKRIDFNTPELQRKRRIRALKDRLTRWYVLVGGLAVLGAITLIFFFL
GYVVAPLFQGANLTAKDAITPAWMQDAGKPLMISLEEQNQVAMRVSDKGQALFFDVDSGA
ELSRIDLPIPAGTSVTAIGKDQPGHPLVVVGLSNGQALVFRHTYKVSYPEGKKTISPAIE
FPYGETPIALNEQGGALEHVSLNATDSTLLLAGSTGSQLHVLSLSSEENMMTGEVTNEQK
RIELPQMTEPVKNIFVDPRQQWLYVVNGRAQADVFSLSDKSLNGRYKLLDDGEAQVTAST
QLVGGISLIIGDSKGGLAQWFMARDTDGEQRLKQIRTFQMGTTPIVEITAEERRKGFVAL
DTAGKLGVFHSTAHRTLLVNQVVDGAGLFGLSPRANRIIVEQGGKLQPLLLDNPHPEVSW
SALWSKVWYENYDEPKYVWQSTAANTDFEPKMSLSPLTFGTLKAAFYAMLLAAPLAVAAA
IYTAYFMAPGMRRKVKPVIELMEAMPTVILGFFAGLFLAPYVEGHLPGIFSLLMLLPIGI
LVAGFIFSRLPESIRLKVPDGWESAILIPVILFVGWLSLFMSPYMEAWFFGGDMRMWISH
DLGITYDQRNALVVGLAMGFAVIPNIYSIAEDAVFSVPRGLTLGSLALGATPWQTMTRVV
ILTASPGIFSALMIGMGRAVGETMIVLMATGNTPVMEMNLFEGLRTLAANVAVEMPESEV
GGSHYRVLFLSALVLLLFTFIMNTLAELIRQRLRKKYSSL