Protein Info for AO353_09890 in Pseudomonas fluorescens FW300-N2E3

Annotation: phosphate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 31 to 277 (247 residues), 414.9 bits, see alignment E=5.1e-129 PF00005: ABC_tran" amino acids 47 to 201 (155 residues), 110.8 bits, see alignment E=8.5e-36

Best Hits

Swiss-Prot: 97% identical to PSTB_PSEPF: Phosphate import ATP-binding protein PstB (pstB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 96% identity to ppf:Pput_5234)

MetaCyc: 64% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WTT4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>AO353_09890 phosphate ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E3)
MQHETHTHGINMSALGRDKQSLNLAQETVAIEVPSLSLFYGDKQALFDVSMNIPKQRVTA
FIGPSGCGKSTLLRTFNRMNDLVDGCRVEGEINLYGNNIYRKGEDVAELRRRVGMVFQKP
NPFPKTIYENVVYGLRIQGINKKRVLDEAVEWALKGAALWDEVKDRLHESALGLSGGQQQ
RLVIARTIAVEPEVLLLDEPCSALDPISTLKVEELIYELKSKFTIVIVTHNMQQAARVSD
YTAFMYMGKLVEFGDTDTLFTNPAKKQTEDYITGRYG