Protein Info for AO353_09835 in Pseudomonas fluorescens FW300-N2E3

Annotation: rubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00301: Rubredoxin
  • amino acids 3 to 49 (47 residues), 76.6 bits, E=6.1e-26

Best Hits

Swiss-Prot: 85% identical to RUBR1_PSEAE: Rubredoxin-1 (rubA1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a132)

MetaCyc: 63% identical to rubredoxin 1 (Mycobacterium tuberculosis H37Rv)
Alkane 1-monooxygenase. [EC: 1.14.15.3]

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

• octane oxidation (4/5 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Fatty acid metabolism
• Retinol metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.3

Sequence Analysis Tools

See A0A0N9WTS8 at UniProt or InterPro

Protein Sequence (56 amino acids)

>AO353_09835 rubredoxin (Pseudomonas fluorescens FW300-N2E3)
MKKWQCVVCGLIYNEADGWPDDGIAAGTPWQDVPEDWLCPDCGVGKMDFEMIEIAA