Protein Info for AO353_09825 in Pseudomonas fluorescens FW300-N2E3

Annotation: integration host factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 115.6 bits, see alignment E=4.8e-38

Best Hits

Swiss-Prot: 91% identical to DBHA_PSEAE: DNA-binding protein HU-alpha (hupA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05787, DNA-binding protein HU-alpha (inferred from 94% identity to psb:Psyr_5027)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D0TK40 at UniProt or InterPro

Protein Sequence (91 amino acids)

>AO353_09825 integration host factor (Pseudomonas fluorescens FW300-N2E3)
MRKPDLAAAIAEKADLTKEQANRVLNAVLEEITGALHRKDSVTLVGFGTFLQRHRGARTG
KNPQTGEPVKIKASNTVAFKPGKSLKDSVNP