Protein Info for AO353_09740 in Pseudomonas fluorescens FW300-N2E3

Annotation: ankryin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF12796: Ank_2" amino acids 43 to 110 (68 residues), 39.4 bits, see alignment E=1.9e-13 PF13637: Ank_4" amino acids 52 to 106 (55 residues), 30.3 bits, see alignment 1e-10 amino acids 87 to 131 (45 residues), 24.5 bits, see alignment 6.8e-09 amino acids 120 to 172 (53 residues), 23.7 bits, see alignment 1.2e-08 PF00023: Ank" amino acids 52 to 74 (23 residues), 17.9 bits, see alignment (E = 7.6e-07) amino acids 121 to 147 (27 residues), 21.1 bits, see alignment (E = 7.3e-08)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W4R1 at UniProt or InterPro

Protein Sequence (385 amino acids)

>AO353_09740 ankryin (Pseudomonas fluorescens FW300-N2E3)
MNNPEEIYEKNIKILLTIHTDIASGNAASLKKHLEKNSVLLHLPMYGLDGHETLLHMAAE
QGQTEICRLLVSLGIALDQPAVSCGNSTPLAAAAGNGHLQTCQWFLEAGALVDGWPNSIT
TPLIDAITFGHQDVVNLLIEHHANINRLHTRLNTAPLDIANTWGFTEIASTLKKSGAVSI
MDTVESRPEEFGSSIVTFVHNTAGWVLPAQLSPVTNEEGLELRISCIDGKNKFKLLFTIG
LFAKSPHTELFVCLPGDWPLTQQGFTPHSPWVFPVEFLSLLAHHTFDDGPLSEGFLIRRS
DARYANLAWPDEVDAFVAVDKAWDTKTEKETIPDDEKVMLYVLAPVKFTKKGEPDAAALR
ALTQRKRTASWASVVIPAPDPEIMQ