Protein Info for AO353_09580 in Pseudomonas fluorescens FW300-N2E3

Annotation: EvpB family type VI secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR03355: type VI secretion protein, EvpB/VC_A0108 family" amino acids 18 to 492 (475 residues), 722.5 bits, see alignment E=1.2e-221 PF05943: VipB" amino acids 68 to 370 (303 residues), 451.4 bits, see alignment E=1.3e-139 PF18945: VipB_2" amino acids 380 to 491 (112 residues), 145.3 bits, see alignment E=8.5e-47

Best Hits

KEGG orthology group: K11900, type VI secretion system protein ImpC (inferred from 97% identity to pba:PSEBR_a5559)

Predicted SEED Role

"Uncharacterized protein ImpC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H159 at UniProt or InterPro

Protein Sequence (497 amino acids)

>AO353_09580 EvpB family type VI secretion protein (Pseudomonas fluorescens FW300-N2E3)
MTDSVRADAQTLGTTEEASEFASLLLQEFKPKTDRAREAVETAVRTLAEQALAQTDLVSN
DAIKSIESIIAAIDAKLTAQVNQVIHHPDFQQLESAWRGLHYLVNNTESDEQLKIRVLNI
SKTDLHKTLKKFKGTAWDQSPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGE
LSKVCAAMHSPFIAAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIG
LTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWANAAYAMAVNINRSFKHFGWCS
RIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDF
AAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEM
QRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEDVEGNPGYYTSKFFLRPHYQLEG
LTVSLRLVSKLPSAKGA