Protein Info for AO353_09565 in Pseudomonas fluorescens FW300-N2E3

Annotation: type VI secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR03354: type VI secretion system FHA domain protein" amino acids 3 to 467 (465 residues), 437.9 bits, see alignment E=3.7e-135 PF00498: FHA" amino acids 30 to 97 (68 residues), 59.4 bits, see alignment E=3.9e-20 PF20232: T6SS_FHA_C" amino acids 287 to 465 (179 residues), 214.2 bits, see alignment E=1.3e-67

Best Hits

KEGG orthology group: K11894, type VI secretion system protein ImpI (inferred from 78% identity to pba:PSEBR_a5556)

Predicted SEED Role

"Uncharacterized protein ImpI/VasC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WH87 at UniProt or InterPro

Protein Sequence (473 amino acids)

>AO353_09565 type VI secretion protein (Pseudomonas fluorescens FW300-N2E3)
MSLCLTITSYHKITPGQCSEKSMDRGMMAIGRNSDNDWVLPDPQRLISGKHCVIQYKDGR
YYLTDNSTNGVELVKAGIRLRKGNSEPLQDGEVIRIGDYDIQVRIDFSLPVTDSNPFADS
SNSFEALMGHQGAAANTPTSLPITPPAHFQGGSAMDTVSDLFDFLSPTSVPPATQPDHVP
AEQHDFRPPTPIPNPAPVAVPVPLASASVIPEDWDLFSDKSAPVTVAPLPVAPLPVAEVT
PSPAPQISTPIAPAPLHEPPVAIVEREVNPVSPADNAQPDLLQAFLRGAGLDQLRLDKAQ
AEAQMESIGRSYRLMVEGLIDVLRARSSLKGEFRIQQTMIQPVENNPLKFAPNVDEAMLL
LLRHSSQAFMAPDLAVRDSFDDLRAHQLAVMAGVEAAIKHLLARFEPAQLEERMGKPGGL
SSLFNGSRQAQYWQQFTELYSKISREAQEDFQDLFGREFSRAYEEHSTRPRRG