Protein Info for AO353_09550 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 162 to 180 (19 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 49 to 258 (210 residues), 242.1 bits, see alignment E=5.4e-76 PF09850: DotU" amino acids 50 to 252 (203 residues), 237.2 bits, see alignment E=1.4e-74 TIGR03350: type VI secretion system peptidoglycan-associated domain" amino acids 290 to 426 (137 residues), 171.2 bits, see alignment E=1.1e-54 PF00691: OmpA" amino acids 322 to 420 (99 residues), 49.3 bits, see alignment E=5.2e-17

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 92% identity to pba:PSEBR_a5553)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W4N1 at UniProt or InterPro

Protein Sequence (432 amino acids)

>AO353_09550 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MNNDDRTQFMPTPGGRGADPARPDPGRAQSAPLSMPAAPVLTGKAEGLNPLESAAGPLLA
LMSRLRNTIAHPAPASLRAQLLAYLRQFEERAEAAGVVRNDVLLARYALCTALDEAVLST
PWGGSSDWGKQSLLITVHNEAKGGEKVFQLLEHCLQSPRERLYLLELLYLCMCLGFEGRY
RVINDGRSQLEALRERTSAVIRSARGDYERELSPHWRGVAVARDRLAQFMPPWIAVAIGV
ALLLALLFGLRLKLAADAEPVFKNIHALGEIPVQAIDRPVVQPKLIERPRLAGFLADEIK
AGRVAVEDAVDRSVVTIRGDELFASGSASIVDNFQPLMLRIAEAIRMVKGQVRVTGHSDN
RPIATLRFPSNWALSEARATSVLQILSAKTGQPERFSAEGRSDTEPLASNATTEGRARNR
RVEITVLAEGVE