Protein Info for AO353_09325 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 253 to 273 (21 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF04073: tRNA_edit" amino acids 28 to 139 (112 residues), 43.5 bits, see alignment E=3.1e-15 PF08668: HDOD" amino acids 194 to 394 (201 residues), 154.6 bits, see alignment E=2.4e-49

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfo:Pfl01_5560)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WH58 at UniProt or InterPro

Protein Sequence (466 amino acids)

>AO353_09325 histidine kinase (Pseudomonas fluorescens FW300-N2E3)
MTEVALAPEAPHAPSVIRLLLGKLGISYAEVLDRPGLNPARKVQAVLVDDAVGALMVLFP
QSQLLDLNRLAELTGRRLTAVPTERLERMLGKHNLSFLPGLPALTSSPCLYEESLLREPQ
LLINSGETGVLLEITSEDFKSMLTKASAANFGEALSSIRPNLDRPDDDREEITQAVQAFT
ARRIQQRLEATIEIPPLAETAQKIIKLRVDPNATIDDITGVVETDPALAAQVVSWAASPY
YASPGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKDHPQHTTPYWHQSIYTAAVI
EGLTRAMPRAQRPEAGLTYLAGLLHNFGYLLLAHVFPPHFSLICRHLEVNPHLCHSFVEQ
HLLGISREQIGAWLMRYWDMPDELSTALRFQHDPSYDGDYAEYPNLVCLAVRLLRSRGIG
SGPDEEIPDALLDRLGLTRDKANDVVSKVLEAEVLLRELASQFTQS