Protein Info for AO353_09300 in Pseudomonas fluorescens FW300-N2E3

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 112 to 134 (23 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 102 to 311 (210 residues), 346.8 bits, see alignment E=2.4e-108 PF01618: MotA_ExbB" amino acids 186 to 293 (108 residues), 110.1 bits, see alignment E=3.3e-36

Best Hits

Swiss-Prot: 77% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 86% identity to pba:PSEBR_a5537)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VMZ2 at UniProt or InterPro

Protein Sequence (331 amino acids)

>AO353_09300 biopolymer transporter ExbB (Pseudomonas fluorescens FW300-N2E3)
MTRNSLSASPTTLARPTRALSAVAALLFSLLLAPTATFAVEPTATAPAATASAPAAADHA
DHAATVVTPVATNPALATEDAAADAPEVLEADNSLGMAHDLSPWGMYQNADIIVKIVMIG
LAIASIITWTIWIAKGLELLGAKRRLRGEITSLKKATTLKDASASAAKEGTLANLLVHDA
LEEMRLSANSREKEGIKERVSFRLERLVAACGRNMSSGTGVLATIGSTAPFVGLFGTVWG
IMNSFIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSD
ASAQVLLLVSRDLDHLPPERIPSQPHMVKVG