Protein Info for AO353_09125 in Pseudomonas fluorescens FW300-N2E3

Annotation: xanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01744: xanthine phosphoribosyltransferase
  • amino acids 2 to 189 (188 residues), 292.1 bits, E=8.6e-92
• PF00156: Pribosyltran
  • amino acids 34 to 157 (124 residues), 26.5 bits, E=1.8e-10

Best Hits

Swiss-Prot: 97% identical to XPT_PSEF5: Xanthine phosphoribosyltransferase (xpt) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03816, xanthine phosphoribosyltransferase [EC: 2.4.2.22] (inferred from 97% identity to pfl:PFL_6032)

Predicted SEED Role

"Xanthine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

• xanthine and xanthosine salvage (2/2 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

See A0A0N9VMW8 at UniProt or InterPro

Protein Sequence (190 amino acids)

>AO353_09125 xanthine phosphoribosyltransferase (Pseudomonas fluorescens FW300-N2E3)
VEALHKKIREEGIVLSDQVLKVDAFLNHQIDPQLMKLIGDEFATLFKDSGITKIVTIEAS
GIAPAIMTGLNLGVPVIFARKHQSLTLTENLLSASVYSFTKQTESTVAISPRHLTSSDRV
LIIDDFLANGKASQALISIIKQAGATVAGLGIVIEKSFQGGRAELDAQGYRVESLARVKS
LADGVVTFIE