Protein Info for AO353_08910 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF02639: DUF188" amino acids 18 to 146 (129 residues), 134.5 bits, see alignment E=9.3e-44

Best Hits

Swiss-Prot: 89% identical to Y5469_PSEPF: UPF0178 protein Pfl01_5469 (Pfl01_5469) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09768, hypothetical protein (inferred from 89% identity to pfo:Pfl01_5469)

Predicted SEED Role

"probable P23 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WED2 at UniProt or InterPro

Protein Sequence (151 amino acids)

>AO353_08910 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MRVWIDADACPRAAKDLVVKFALKRQFEVVMVAGQPQIKPGLALVRLIVVPSGPDAADDY
LVEHAVPGELVICSDVPLADRLVKKGVAALDPRGKEFDAQNMGDRLAVRNLFTDLREQGQ
MGGGPAPFGDREKQAFANALDRIITRLSRKP