Protein Info for AO353_08690 in Pseudomonas fluorescens FW300-N2E3

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01892: acetylornithine deacetylase (ArgE)
  • amino acids 10 to 374 (365 residues), 391.7 bits, E=1.7e-121
• PF01546: Peptidase_M20
  • amino acids 73 to 375 (303 residues), 105.9 bits, E=2.9e-34
• PF07687: M20_dimer
  • amino acids 174 to 282 (109 residues), 79.4 bits, E=1.8e-26

Best Hits

Swiss-Prot: 49% identical to ARGE_PHOLL: Acetylornithine deacetylase (argE) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 90% identity to pfo:Pfl01_5420)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

See A0A0N9WG39 at UniProt or InterPro

Protein Sequence (382 amino acids)

>AO353_08690 acetylornithine deacetylase (Pseudomonas fluorescens FW300-N2E3)
MPLPSMKDQFAALIAAPSVSCTQPSLDQSNRAVIDLLATWLGDLGFSCDIQQVSPGKFNL
LASFGSGPGGLVLAGHSDTVPFDGALWQTDPLKLTEVDGRWVGLGSCDMKGFFALAIEAV
LPLLDKPFKQPLMILATCDEESSMAGARALAAAGRPLGRVAVIGEPTGLKPIRMHKGVMM
ERIDILGQSGHSSDPRLGHSALEAMHDAMGELRGLRLQWQREFHNPQFSVPQPTLNFGCI
HGGDNPNRICGQCSLEFDLRPLPGMDPNALRAAIRQKLEPVAELHQVKIDYAPLFPEVPP
FEQAADSELVQVAERLTGHLAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLEM
SRLQPTVHLLRQLIEHYCLTPA