Protein Info for AO353_08670 in Pseudomonas fluorescens FW300-N2E3

Annotation: NADPH-dependent FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 1 to 141 (141 residues), 118.2 bits, E=1.3e-38
• TIGR03567: FMN reductase
  • amino acids 3 to 172 (170 residues), 242 bits, E=1.7e-76

Best Hits

Swiss-Prot: 77% identical to SSUE_PSEPU: FMN reductase (NADPH) (ssuE) from Pseudomonas putida

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 94% identity to pba:PSEBR_a5413)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• two-component alkanesulfonate monooxygenase (2/2 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
• dibenzothiophene desulfurization (1/5 steps found)
• bacterial bioluminescence (3/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

See A0A0N9WE81 at UniProt or InterPro

Protein Sequence (197 amino acids)

>AO353_08670 NADPH-dependent FMN reductase (Pseudomonas fluorescens FW300-N2E3)
MLVVSLGGSPSQRSRSGVLLDRSQRWLQQQGVEVVSYQVRDFPAEDLLHARFDSPKVVDL
LQQIENADGLLIATPVYKASFSGALKTVLDLLPERALSHKVVLPMATGGSIAHMLAVDYA
LKPVLSALKAQEMLHGIFAEDSQIAYGEGSAQAQLSPALEQRLVEALEQFFSAMARRPKP
LDPNLLNERLLSARWSI