Protein Info for AO353_08650 in Pseudomonas fluorescens FW300-N2E3

Annotation: aliphatic sulfonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00005: ABC_tran" amino acids 30 to 163 (134 residues), 112 bits, see alignment E=1.8e-36

Best Hits

Swiss-Prot: 92% identical to SSUB_PSEPF: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 93% identity to pfl:PFL_5934)

MetaCyc: 74% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHX8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>AO353_08650 aliphatic sulfonate ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E3)
MTAQQPPRLLRGIPLVVRKLQKTFGARQVLREIDLHIPAGQFVAVVGRSGCGKSTLLRLL
AGLDQPTDGELLAGSASLDEAREDTRLMFQEARLLPWKKVIDNVGLGLKGDWRQQALDAL
DAVGLADRADEWPAALSGGQKQRVALARALIHQPRLLLLDEPLGALDALTRIEMQQLIER
LWQQHGFTVLLVTHDVSEAVAIADRVLLIEEGEIGLDLQVELPRPRVRGSHRLAALETEV
LNRVLSLPGSPPAPEPVSPLPTQLRWAH