Protein Info for AO353_08430 in Pseudomonas fluorescens FW300-N2E3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 15 to 58 (44 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 249 (231 residues), 80.1 bits, see alignment E=2.3e-26 amino acids 241 to 390 (150 residues), 69.8 bits, see alignment E=3.1e-23 PF00083: Sugar_tr" amino acids 43 to 187 (145 residues), 43.5 bits, see alignment E=3.1e-15 amino acids 222 to 387 (166 residues), 31.8 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 67% identity to bxe:Bxe_B0054)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W426 at UniProt or InterPro

Protein Sequence (393 amino acids)

>AO353_08430 MFS transporter (Pseudomonas fluorescens FW300-N2E3)
VNQVRSESLRIPRTIWALGFVSLFMDVSSELVHSLLPVFLVTTLGASALTVGVIEGIAEA
TAMVVKVFSGAISDFIGRRKGLLLVGYGMAALSKPLFPLAHSVDVVFTARFLDRIGKGIR
GSPRDALVADVAPPEIRGACFGLRQSMDTVGAFVGPALAIALMLWLADIQLVLWFAVIPA
VIAVALIVAGVKEPEHAVGKHTFRSPIHWRVLHDFSSGYWWVVIVGGVFTLARFSEAFLV
LRAQQAGLSATWVPLVMVVMSVFYALSAYPAGWLSDRISRTKLLCLGMGLLVLADLVLAQ
SHSPLTMMLGVALWGLHMGFSQGILATLVADTAPDELKGTAFGIFNLLSGVCLLIASVLA
GWLWQTVGAQSTFITGAVLAALAMLLLLLRRAA