Protein Info for AO353_08340 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details PF13687: DUF4153" amino acids 67 to 398 (332 residues), 36.1 bits, see alignment E=2.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFX4 at UniProt or InterPro

Protein Sequence (577 amino acids)

>AO353_08340 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MPGLNRFLGFYLLIGLIQGIVFFYSDQLYRVSETLFFVTCTVVLVGGTTLQLLGEKVRQW
RSLLPTLAFTLLMGGMTLWVCYGPEHVVSSRWAINSWFISLVLLSYVCASFLFAWPAVKG
QRWRYEDLFQQAWNSVFIVLYALILVGLFMLLLKLWSRLFLMLGIEFFERHFWSQVFLCF
SLPLVFALGMYLAARSEKVIGQMRGMLFSACGLLLPLIALISVLFTLTLPFTGLDRIWAT
GYSTPILLVLAGAQLFLLNGVFQQGVQTRPYPKWLTHFIELSLLCLPVLAALAFYSSWLR
VEQYALSPQRFVALALALLCGLYGLAAVWAVALRSPAWLGNLRVTNPALALLFCVLLVLI
NTPLLNPVQLSVDDQVRRLLDGRTKAEAFDAHYLRFGLEKAGEEAYAKLQVDLDQERILD
PDARRALRERMDDTSLSFSEQYAKERARRPKPELEWIGPKPKGSEQFAEISLNTDSPCEP
GCVLWAVDLDQDGQNEVLVVPRTSFRHDFKPPRIYALDGKGEWDDRGPLVWTQLPDGNVD
TETLINDIREGRISLVKPRYRQLQSSDMLLTPVIREP