Protein Info for AO353_08250 in Pseudomonas fluorescens FW300-N2E3

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF02881: SRP54_N" amino acids 228 to 293 (66 residues), 51 bits, see alignment E=2.7e-17 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 242 to 512 (271 residues), 369.3 bits, see alignment E=5.9e-115 PF06414: Zeta_toxin" amino acids 306 to 418 (113 residues), 36.6 bits, see alignment E=6.4e-13 PF01583: APS_kinase" amino acids 311 to 359 (49 residues), 21.4 bits, see alignment 4.2e-08 PF00448: SRP54" amino acids 312 to 512 (201 residues), 260.2 bits, see alignment E=2.3e-81

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 80% identity to pfo:Pfl01_5337)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VMG6 at UniProt or InterPro

Protein Sequence (518 amino acids)

>AO353_08250 signal recognition particle-docking protein FtsY (Pseudomonas fluorescens FW300-N2E3)
MFGSNDDKKTPAAAGEKKSLFGWLRKKPQAPAVEQPQPLPEVAPEPVIEAAPVAQAPAAA
VLPIAEPVVQPVVEPAPVAEVPRAPEVVHKPWLTLPVAEEPVALVENELAPHITPPIPAP
TVVQQAVELLVVEPVPVIDPTAEQLIVDEPDLPQPVIAAFVAPERAPEPVPAPVPAPVVA
APVTAPAPVAPVAAPAPVAAEPVRTEETKAGFFARLKQGLSKTSASIGEGMASLFLGKKI
IDDELLEDIETRLLTADVGVEATSVIIQSLTQKVARKQLADADALYKSLQAELANMLKPV
EQPLKITSQNKPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQ
VWGERNKIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVR
RVISKLDADAPHEVLLVLDAGTGQNAISQAKQFNQTVELTGLALTKLDGTAKGGVIFALA
KQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAERERS