Protein Info for AO353_08215 in Pseudomonas fluorescens FW300-N2E3

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 95% identical to THIG_PSEF5: Thiazole synthase (thiG) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 94% identity to ppw:PputW619_0361)

MetaCyc: 51% identical to thiazole synthase (Bacillus subtilis subtilis 168)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WGI8 at UniProt or InterPro

Protein Sequence (264 amino acids)

>AO353_08215 thiazole synthase (Pseudomonas fluorescens FW300-N2E3)
MSNVRSDKPFVLAGRTYQSRLLVGTGKYRDMEETRLAIEASGAEIVTFAVRRTNLGQNPG
EPNLLEVLSPDRYTFLPNTAGCFDATEAVRTCRLARELLGGHNLVKLEVLADQKTLFPNV
IETLKAAEVLVKEGFDVMVYTSDDPIIARQLAEIGCIAVMPLAGLIGTGLGICNPYNLQI
ILEEAKIPVLVDAGVGTASDATIAMELGCEAVLMNSAIAHAQQPIMMAEAMKHAIVAGRL
AYLAGRMPKKLYASASSPLDGLIK