Protein Info for AO353_08210 in Pseudomonas fluorescens FW300-N2E3

Annotation: tRNA (guanine-N7)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 54 to 240 (187 residues), 198.7 bits, see alignment E=3.1e-63 PF02390: Methyltransf_4" amino acids 66 to 235 (170 residues), 186.5 bits, see alignment E=1.5e-59

Best Hits

Swiss-Prot: 97% identical to TRMB_PSEPF: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 97% identity to pba:PSEBR_a5331)

MetaCyc: 61% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VSB6 at UniProt or InterPro

Protein Sequence (241 amino acids)

>AO353_08210 tRNA (guanine-N7)-methyltransferase (Pseudomonas fluorescens FW300-N2E3)
MTESNDTPIQTEAGEERQHRRIKSFVMRAGRMTEGQQRGLDQGTPLFVLPLADAPVDFDQ
VFGRSAPRSLEIGFGMGHSLLEMAAASPDQDFIGVEVHRPGVGALLNGVLTQGLTNLRVY
DCDAIEVLNRCVADNSLDRLMLFFPDPWHKSRHHKRRIVQASFAELVRSKLKVGGVLHMA
TDWEPYAEYMLEVMNVAPGYRNLAEDGKCVPRPAERPITKFERRGERLGHGVWDLKFEKQ
S