Protein Info for AO353_08185 in Pseudomonas fluorescens FW300-N2E3

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07021: MetW
  • amino acids 2 to 194 (193 residues), 327.6 bits, E=7e-102
• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 2 to 195 (194 residues), 303 bits, E=3.8e-95
• PF13489: Methyltransf_23
  • amino acids 10 to 101 (92 residues), 43.4 bits, E=8.9e-15
• PF13847: Methyltransf_31
  • amino acids 15 to 104 (90 residues), 41 bits, E=5.2e-14
• PF13649: Methyltransf_25
  • amino acids 18 to 102 (85 residues), 41.2 bits, E=6.6e-14
• PF08242: Methyltransf_12
  • amino acids 19 to 101 (83 residues), 30.7 bits, E=1.3e-10
• PF08241: Methyltransf_11
  • amino acids 19 to 104 (86 residues), 47.9 bits, E=5.4e-16

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a5326)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

See A0A0N9VMF7 at UniProt or InterPro

Protein Sequence (206 amino acids)

>AO353_08185 methionine biosynthesis protein MetW (Pseudomonas fluorescens FW300-N2E3)
MRADLEIIQEWIPAGSRVLDLGCGDGELLTWLRDNKQVTGYGLENDADNIAECVAKGINV
IEQDLDKGLGNFASNSFDIVVMTQALQAVHYPDKILDEMLRVGRQCIITFPNFGHWRCRW
YLASKGRMPVSEFLPYTWYNTPNIHFCTFADFEALCREREAKVIDRLAVDQQHRHGWASK
LWPNLLGEIGIYRVSSPGLQDHQVAV