Protein Info for AO353_08060 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF01042: Ribonuc_L-PSP" amino acids 4 to 114 (111 residues), 90.8 bits, see alignment E=3.4e-30

Best Hits

Swiss-Prot: 36% identical to Y3206_SACS2: RutC family protein SSO3206 (SSO3206) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: None (inferred from 80% identity to pfl:PFL_5807)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VSZ0 at UniProt or InterPro

Protein Sequence (116 amino acids)

>AO353_08060 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MTITRINSNSCLSGAVTFGELVFLSGQVPGDSTDVSGQTREVLEKIDALLAEAGSDKDHL
LSATIYLKDIGQDFAAMNDVWSAWLSPGHAPSRTTLQAELARPQVLVEITVIAARR