Protein Info for AO353_08015 in Pseudomonas fluorescens FW300-N2E3

Annotation: 5,10-methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02219: MTHFR
  • amino acids 4 to 277 (274 residues), 301.9 bits, E=2.4e-94
• TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]
  • amino acids 7 to 278 (272 residues), 335.3 bits, E=1.4e-104

Best Hits

Swiss-Prot: 43% identical to METF_AQUAE: 5,10-methylenetetrahydrofolate reductase (metF) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 94% identity to pba:PSEBR_a5284)

MetaCyc: 39% identical to 5,10-methylenetetrahydrofolate reductase (Escherichia coli K-12 substr. MG1655)
RXN-22438 [EC: 1.5.1.54]

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• folate transformations I (9/13 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20 or 1.5.1.54

Sequence Analysis Tools

See A0A0N9VMC9 at UniProt or InterPro

Protein Sequence (281 amino acids)

>AO353_08015 5,10-methylenetetrahydrofolate reductase (Pseudomonas fluorescens FW300-N2E3)
MSQDRRYSFEFFPTKTDAGHEKLIATARQLATYNPDFFSCTYGAGGSTRDRTLNTVLQLE
SEVKVPAAPHLSCVGDSKADLRGLLAQYKAAGIKRIVALRGDLPSGMGMASGELRHANDL
VSFIREETGDHFHIEVAAYPEMHPQARNFEDDLTNFVRKANAGANSAITQYFFNADSYFY
FVERVQAMGVNIPVVPGIMPITNYSKLARFSDACGAEIPRWVRKQLEAYGDDTQSIQGFG
EQVITEMCERLLQGGAPGLHFYTLNQAEPSLAVWNNLKLPR