Protein Info for AO353_07960 in Pseudomonas fluorescens FW300-N2E3

Annotation: ArsR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF12840: HTH_20" amino acids 24 to 72 (49 residues), 34.6 bits, see alignment 6.1e-12 PF01022: HTH_5" amino acids 25 to 70 (46 residues), 27.7 bits, see alignment 7.9e-10 PF01209: Ubie_methyltran" amino acids 126 to 271 (146 residues), 26.2 bits, see alignment E=1.9e-09 PF13489: Methyltransf_23" amino acids 150 to 277 (128 residues), 63.8 bits, see alignment E=6.4e-21 PF13847: Methyltransf_31" amino acids 165 to 274 (110 residues), 60.4 bits, see alignment E=7.1e-20 PF13649: Methyltransf_25" amino acids 170 to 260 (91 residues), 55.8 bits, see alignment E=2.5e-18 PF08242: Methyltransf_12" amino acids 170 to 262 (93 residues), 51.6 bits, see alignment E=5.1e-17 PF08241: Methyltransf_11" amino acids 171 to 263 (93 residues), 60.6 bits, see alignment E=7.4e-20

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 91% identity to pfo:Pfl01_5268)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VMB7 at UniProt or InterPro

Protein Sequence (331 amino acids)

>AO353_07960 ArsR family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MNLRVPSIRHDDCDELAALCKAGGDPLRLNVLRALANDSFGVLELAQIFATGQSGMSHHL
KVLAQAELVATRREGNAIFYRRALPHTELLGGKLHAALLDEVDNLTLPSDVQARISQVHG
QRAAASQDFFSRVAEKFRAQQDLIAGLAQYRESVLALLDKLSFSEGATAIEVGPGDGSFL
PELARRFSQVTALDNSPAMLELARQVCEREKLANVSLQLADALDGVSLEANCVVLNMVLH
HFAAPADALKHMAGLLQPGGSLLVTELCSHNQSWAKEACGDLWLGFEQDDLARWATAAGL
VPGESLYVGLRNGFQIQVRHFQRPAGDTHHR