Protein Info for AO353_07885 in Pseudomonas fluorescens FW300-N2E3

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 PF00072: Response_reg" amino acids 16 to 127 (112 residues), 92.9 bits, see alignment E=4.4e-30 PF00989: PAS" amino acids 155 to 204 (50 residues), 22.7 bits, see alignment 2.4e-08 TIGR00229: PAS domain S-box protein" amino acids 155 to 262 (108 residues), 23.2 bits, see alignment E=6.3e-09 PF08448: PAS_4" amino acids 158 to 262 (105 residues), 25 bits, see alignment E=5.5e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 272 to 434 (163 residues), 138 bits, see alignment E=2.4e-44 PF00990: GGDEF" amino acids 276 to 432 (157 residues), 142.3 bits, see alignment E=3.7e-45 PF00563: EAL" amino acids 452 to 687 (236 residues), 238.8 bits, see alignment E=1.7e-74

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_5255)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WSW7 at UniProt or InterPro

Protein Sequence (707 amino acids)

>AO353_07885 diguanylate cyclase (Pseudomonas fluorescens FW300-N2E3)
MECAQPKPVEGSSVLLIVDDYPENLISMRALLQRQDWQVMTAASGFEALSLLLEHEIDLV
LLDVQMPEMDGFEVARLMRGSQRTRLTPIIFLTANEQSQDAVIKGYASGAVDYLFKPFDP
QILKPKVQALLEHQRNRRALQRLSQDLEAARAFNASVLDNAAEGILVVGDDGLIRFANPA
MSRLLNATVTELQGAEFVDFLQKPHVPVWAESDIYAGYQRGETWRVHDAILRTAPGQQVP
VALSCAPLPSEQRAMVVTVLDMSVVRHLHQQLEFQAVTDPLTGLLNRRGFYQTAENLLLR
GERSDSAWVLLYLDLDGFKRVNDSLGHDAGDRVLRWVSEQLKACLRPFDILARMGGDEFT
ALLDLEFPEQAAKIAEKLIERISICQQIEGLDVVLGASIGIATYPDCGSNLDGLLRASDI
AMYEAKRAGRQQYRFYDHEMNGRARSRLMLEESVRTAIENQDFNLVYQPQVAIADGRVRG
FEALLRWQHPSVGDVPPGLFLPLLEEARLISRLGSWIYHRGAKQRKAWETLFAKDLVLAV
SLSSTQFGMPNLVTELRQVLERHELQPCQLEVEITEDALIQNVDESRKQLRLLRHLGVRV
ALDDFGSGPCSLAHLRDLQLDTLKLDRHLIARIPDSPRDAALVRSVTELCREFGMLVIAE
GVETVAQYRWLEANGCQYVQGFLVARPLIAEDAGGFAQPFDWSALTA